A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10245 |
Swiss-prot Accession number | Q9W7M8 (Sequence in FASTA format) |
Description | Thymosin beta. |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 45 Amino acids |
Molecular weight | 5208 |
References | 1 PubMed abstract 10068630 |
Domain Name | Thymosin |
Hormone Name | Thymosin beta |
Mature Hormone Sequence | ADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (2-45) |
Receptor | N/A |
Gene ID | 402820 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10830 |
Swiss-prot Accession number | O73727 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11904 |
References | 1 PubMed abstract 9492081 2 Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | NPGTPQHLCGSHLVDALYLVCGPTGFFYNP |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (22-51) |
Receptor | N/A |
Gene ID | 30262 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10831 |
Swiss-prot Accession number | O73727 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11904 |
References | 1 PubMed abstract 9492081 2 Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHKPCSIFELQNYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (88-108) |
Receptor | N/A |
Gene ID | 30262 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11569 |
Swiss-prot Accession number | Q0D250 (Sequence in FASTA format) |
Description | Putative leptin (Novel protein similar to veterbrate LEP, leptin (Obesity homolog, mouse)(LEP)) |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 166 Amino acids |
Molecular weight | 18962 |
References | 1 PubMed abstract 16935838 |
Domain Name | N/A |
Hormone Name | Leptin |
Mature Hormone Sequence | |
Position of mature hormone in Pre-Hormone protein | |
Receptor | N/A |
Gene ID | 100150233 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11584 |
Swiss-prot Accession number | Q6XQJ0 (Sequence in FASTA format) |
Description | Renin |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the peptidase A1 family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 395 Amino acids |
Molecular weight | 43072 |
References | 1 PubMed abstract 14645735 |
Domain Name | A1_Propeptide Asp |
Hormone Name | Renin |
Mature Hormone Sequence | |
Position of mature hormone in Pre-Hormone protein | |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11585 |
Swiss-prot Accession number | Q6YA65 (Sequence in FASTA format) |
Description | Renin |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the peptidase A1 family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 395 Amino acids |
Molecular weight | 43037 |
References | ---- |
Domain Name | A1_Propeptide Asp |
Hormone Name | Renin |
Mature Hormone Sequence | |
Position of mature hormone in Pre-Hormone protein | |
Receptor | N/A |
Gene ID | 405786 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |